PDB entry 5f9c

View 5f9c on RCSB PDB site
Description: Crystal structure of the G121R mutant of human phosphoglucomutase 1
Class: isomerase
Keywords: isomerase metabolism, ISOMERASE
Deposited on 2015-12-09, released 2016-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (0-561)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d5f9ca1, d5f9ca2, d5f9ca3, d5f9ca4
  • Chain 'B':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (Start-561)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d5f9cb1, d5f9cb2, d5f9cb3, d5f9cb4
  • Heterogens: MG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f9cA (A:)
    mvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvg
    gdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashnp
    rgpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlenk
    fkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilcee
    lgapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkh
    gffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgwk
    ffgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqky
    grnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpv
    dgsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlapli
    sialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f9cA (A:)
    mvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvg
    gdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashnp
    rgpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlenk
    fkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilcee
    lgapansavncvpledfnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffvnps
    dsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgwkffgnlmd
    asklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqkygrnfftr
    ydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvdgsisrn
    qglrliftdgsrivfrlsgatirlyidsyekdvakinqdpqvmlaplisialkvsqlqer
    tgrtaptvit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5f9cB (B:)
    mvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvg
    gdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashnp
    rgpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlenk
    fkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilcee
    lgapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkh
    gffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgwk
    ffgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqky
    grnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpv
    dgsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlapli
    sialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f9cB (B:)
    vkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvgg
    dgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltnprgdf
    gikfnisnggpapeaitdkifqisktiyavcpdlkvdlgvlgkqqfdlenkfkpftveiv
    dsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansav
    ncvpledyaadlvetmksgehdfgaafdgdgdrnmilgkhgffvnpsdsvaviaanifsi
    pyfqqtgvrgfarsmptsgaldrvasatkialyetptgwkffgnlmdasklslcgeesfg
    tgsdhirekdglwavlawlsilatrkqsvedilkdhwqkygrnfftrydyeeveaegank
    mmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvdgsisrnqglrliftdgsri
    vfrlsatirlyidsyekdvakinqdpqvmlaplisialkvsqlqertgrtaptvit