PDB entry 5f8r

View 5f8r on RCSB PDB site
Description: Blood group antigen binding adhesin BabA of Helicobacter pylori strain S831 in complex with blood group H Lewis b hexasaccharide
Class: cell adhesion
Keywords: Adhesin, Lectin, Nanobody, Complex, Cell Adhesion
Deposited on 2015-12-09, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adhesin binding fucosylated histo-blood group antigen,Adhesin,Adhesin binding fucosylated histo-blood group antigen
    Species: Helicobacter pylori [TaxId:210]
    Gene: babA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52269 (Start-194)
    • Uniprot Q6DSZ5 (195-203)
    • Uniprot O52269 (204-457)
      • expression tag (458-459)
  • Chain 'B':
    Compound: Adhesin binding fucosylated histo-blood group antigen,Adhesin,Adhesin binding fucosylated histo-blood group antigen
    Species: Helicobacter pylori [TaxId:210]
    Gene: babA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52269 (Start-194)
    • Uniprot Q6DSZ5 (195-203)
    • Uniprot O52269 (204-457)
      • expression tag (458-459)
  • Chain 'C':
    Compound: Nanobody Nb-ER19
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5F8R
    Domains in SCOPe 2.07: d5f8rc1, d5f8rc2
  • Chain 'D':
    Compound: Nanobody Nb-ER19
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5F8R
    Domains in SCOPe 2.07: d5f8rd1, d5f8rd2
  • Heterogens: BGC, GAL, NAG, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5f8rC (C:)
    qvqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnya
    dsvkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f8rC (C:)
    vqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyad
    svkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5f8rD (D:)
    qvqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnya
    dsvkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f8rD (D:)
    vqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyad
    svkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvssh