PDB entry 5f74

View 5f74 on RCSB PDB site
Description: Crystal structure of ChREBP:14-3-3 complex bound with AMP
Class: transcription
Keywords: ChREBP, 14-3-3, AMP, Allosteric, TRANSCRIPTION
Deposited on 2015-12-07, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein beta/alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Ywhab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f74a_
  • Chain 'B':
    Compound: Carbohydrate-responsive element-binding protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Mlxipl, Wbscr14
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f74A (A:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy
    lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenqgdegd
    agegen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f74A (A:)
    tmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrssw
    rvissieqktnekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfylkm
    kgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfyyei
    lnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwts
    

  • Chain 'B':
    No sequence available.