PDB entry 5f6u

View 5f6u on RCSB PDB site
Description: Crystal Structure of Ubc9 (K48A/K49A/E54A) complexed with Fragment 8 (JSS190B146)
Class: LIGASE/LIGASE inhibitor
Keywords: Ubc9, sumoylation, Drug Discovery, LIGASE-LIGASE inhibitor complex
Deposited on 2015-12-07, released 2016-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SUMO-conjugating enzyme UBC9
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2I, UBC9, UBCE9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63279 (0-End)
      • engineered mutation (46-47)
      • engineered mutation (52)
    Domains in SCOPe 2.08: d5f6ua_
  • Heterogens: 5VK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5f6uA (A:)
sgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgaagtpwagglfklr
mlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqelln
epniqdpaqaeaytiycqnrveyekrvraqakkfaps

    Sequence, based on observed residues (ATOM records): (download) 
    >5f6uA (A:)
sgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgaagtpwagglfklr
mlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqelln
epniqdpaqaeaytiycqnrveyekrvraqakkfap