PDB entry 5f6t

View 5f6t on RCSB PDB site
Description: Structure of calexcitin-Gd2+ complex.
Class: calcium-binding protein
Keywords: EF-hand Neuronal calcium signalling, calcium-binding protein
Deposited on 2015-12-06, released 2015-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calexcitin
    Species: Doryteuthis pealeii [TaxId:1051067]
    Gene: Cex
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5f6ta_
  • Heterogens: GD, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f6tA (A:)
    maahqlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhneara
    tlkliwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndt
    sgdniidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrga
    kgnhlfgtlkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f6tA (A:)
    qlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhnearatlkl
    iwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndtsgdn
    iidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrgakgnh
    lfgtl