PDB entry 5f6q

View 5f6q on RCSB PDB site
Description: Crystal Structure of Metallothiol Transferase from Bacillus anthracis str. Ames
Class: transferase
Keywords: alpha-beta fold, Transferase, PSI-Biology, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2015-12-06, released 2015-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metallothiol transferase fosB 2
    Species: Bacillus anthracis [TaxId:1392]
    Gene: fosB2, fosB-2, BA_4109, GBAA_4109, BAS3818
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81W73 (3-141)
      • expression tag (2)
    Domains in SCOPe 2.05: d5f6qa_
  • Chain 'B':
    Compound: Metallothiol transferase fosB 2
    Species: Bacillus anthracis [TaxId:1392]
    Gene: fosB2, fosB-2, BA_4109, GBAA_4109, BAS3818
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81W73 (3-141)
      • expression tag (2)
    Domains in SCOPe 2.05: d5f6qb_
  • Heterogens: ZN, SO4, GOL, CL, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f6qA (A:)
    snamlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveedipr
    neikqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefh
    tgtlqnrleyykedkkhmtfyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f6qA (A:)
    amlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprne
    ikqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtg
    tlqnrleyykedkkhmtfyi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5f6qB (B:)
    snamlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveedipr
    neikqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefh
    tgtlqnrleyykedkkhmtfyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f6qB (B:)
    amlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprne
    ikqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtg
    tlqnrleyykedkkhmtfyi