PDB entry 5f2c

View 5f2c on RCSB PDB site
Description: Thermostable aldehyde dehydrogenase from Pyrobaculum sp. 1860 crystallized in microgravity (complex with NADP+)
Class: oxidoreductase
Keywords: Thermostable aldehyde dehydrogenase, oxidoreductase
Deposited on 2015-12-01, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f2ca_
  • Chain 'B':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f2cb_
  • Chain 'C':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f2cc_
  • Chain 'D':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f2cd_
  • Chain 'E':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f2ce_
  • Chain 'F':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f2cf_
  • Chain 'G':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f2cg_
  • Chain 'H':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5f2ch_
  • Heterogens: NAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f2cA (A:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f2cA (A:)
    lnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawa
    nipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarh
    yqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdt
    pvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaaka
    agtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkf
    ieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnf
    fepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnraf
    riaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrr
    fpipsalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5f2cB (B:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f2cB (B:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5f2cC (C:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f2cC (C:)
    idlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealka
    wanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaela
    rhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpas
    dtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaa
    kaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavad
    kfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswg
    nffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnr
    afriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrt
    rrfpipsalk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5f2cD (D:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f2cD (D:)
    kvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipa
    irraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgr
    vlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtg
    wliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtl
    ktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfiery
    vhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepa
    ifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriae
    avesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpip
    salk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5f2cE (E:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f2cE (E:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psalk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5f2cF (F:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f2cF (F:)
    idlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealka
    wanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaela
    rhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpas
    dtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaa
    kaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavad
    kfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswg
    nffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnr
    afriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrt
    rrfpipsalk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5f2cG (G:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f2cG (G:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psal
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5f2cH (H:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f2cH (H:)
    lnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawa
    nipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarh
    yqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdt
    pvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaaka
    agtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkf
    ieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnf
    fepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnraf
    riaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrr
    fpipsalk