PDB entry 5f21

View 5f21 on RCSB PDB site
Description: human CD38 in complex with nanobody MU375
Class: hydrolase/immune system
Keywords: CD38, ADP-ribosyl cyclase, cyclic ADP-ribose, X-crystallography, Calcium signaling, nanobody, MU375, HYDROLASE-IMMUNE SYSTEM complex
Deposited on 2015-12-01, released 2016-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CD38
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28907 (Start-254)
      • engineered mutation (3)
      • engineered mutation (54)
      • engineered mutation (118)
      • engineered mutation (163)
      • engineered mutation (173)
    Domains in SCOPe 2.06: d5f21a_
  • Chain 'B':
    Compound: nanobody MU375
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5F21
    Domains in SCOPe 2.06: d5f21b_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f21A (A:)
    wrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeed
    yqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefdt
    skinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsv
    evhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkfl
    qcvknpedssctsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f21A (A:)
    twsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeedyqp
    lmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefdtski
    nyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsvevh
    nlqpekvqtleawvihgsrdlcqdptikelesiiskrniqfsckniyrpdkflqcvknpe
    dssctsei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5f21B (B:)
    dvqlqesgggsvqaggsltlsctasgllfrlasmgwyrqapgkereliatitvggktnyk
    dsvqgrfiitrdntgdntkstvtlqmnrlkpedtavyycntaspavgadtwgqgtrvtvs
    sepktpkpqpaaahhhhhhgaaeqkliseedlngaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f21B (B:)
    qlqesgggsvqaggsltlsctasgllfrlasmgwyrqapgkereliatitvggktnykds
    vqgrfiitrdntkstvtlqmnrlkpedtavyycntaspavgadtwgqgtrvtvs