PDB entry 5f1k

View 5f1k on RCSB PDB site
Description: human CD38 in complex with nanobody MU1053
Class: hydrolase/immune system
Keywords: CD38, ADP-ribosyl cyclase, cyclic ADP-ribose, X-crystallography, Calcium signaling, nanobody, MU1053, HYDROLASE-IMMUNE SYSTEM complex
Deposited on 2015-11-30, released 2016-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CD38
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28907
      • engineered mutation (4)
      • engineered mutation (55)
      • engineered mutation (119)
      • engineered mutation (164)
      • engineered mutation (174)
    Domains in SCOPe 2.06: d5f1ka_
  • Chain 'B':
    Compound: ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CD38
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28907
      • engineered mutation (4)
      • engineered mutation (55)
      • engineered mutation (119)
      • engineered mutation (164)
      • engineered mutation (174)
    Domains in SCOPe 2.06: d5f1kb_
  • Chain 'C':
    Compound: nanobody MU1053
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5F1K
    Domains in SCOPe 2.06: d5f1kc_
  • Chain 'D':
    Compound: nanobody MU1053
    Species: Lama glama [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5F1K
    Domains in SCOPe 2.06: d5f1kd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5f1kA (A:)
    rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditee
    dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefd
    tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgs
    vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
    lqcvknpedssctsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f1kA (A:)
    twsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeedyqp
    lmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefdtski
    nyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsvevh
    nlqpekvqtleawvihggrdlcqdptikelesiiskrniqfsckniyrpdkflqcvknpe
    dssc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5f1kB (B:)
    rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditee
    dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefd
    tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgs
    vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
    lqcvknpedssctsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f1kB (B:)
    twsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeedyqp
    lmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefdtski
    nyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsvevh
    nlqpekvqtleawvihrdlcqdptikelesiiskrniqfsckniyrpdkflqcvknp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5f1kC (C:)
    dvqlqesggglvqaggslrlsctgsgrtfrnypmawfrqapgkerefvagitwvgastly
    adfakgrftisrdnakntvylqmnslkpedtavyscaagrgivagripaeyadwgqgtqv
    tvssepktpkpqpaaahhhhhhgaaeqkliseedlngaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f1kC (C:)
    vqlqesggglvqaggslrlsctgsgrtfrnypmawfrqapgkerefvagitwvgastlya
    dfakgrftisrdnakntvylqmnslkpedtavyscaagrgivagripaeyadwgqgtqvt
    vss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5f1kD (D:)
    dvqlqesggglvqaggslrlsctgsgrtfrnypmawfrqapgkerefvagitwvgastly
    adfakgrftisrdnakntvylqmnslkpedtavyscaagrgivagripaeyadwgqgtqv
    tvssepktpkpqpaaahhhhhhgaaeqkliseedlngaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5f1kD (D:)
    vqlqesggglvqaggslrlsctgsgrtfrnypmawfrqapgkerefvagitwvgastlya
    dfakgrftisrdnakntvylqmnslkpedtavyscaagrgivagripaeyadwgqgtqvt
    vss