PDB entry 5ezv

View 5ezv on RCSB PDB site
Description: X-ray crystal structure of AMP-activated protein kinase alpha-2/alpha-1 RIM chimaera (alpha-2(1-347)/alpha-1(349-401)/alpha-2(397-end) beta-1 gamma-1) co-crystallized with C2 (5-(5-hydroxyl-isoxazol-3-yl)-furan-2-phosphonic acid)
Class: transferase
Keywords: Transferase, serine/threonine kinase, allosteric activation, nucleotide-binding
Deposited on 2015-11-26, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-AMP-activated protein kinase catalytic subunit alpha-2/alpha-1 RIM SWAP chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAA2, AMPK, AMPK2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 5'-AMP-activated protein kinase subunit beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAB1, AMPK
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 5'-AMP-activated protein kinase catalytic subunit alpha-2/alpha-1 RIM SWAP chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAA2, AMPK, AMPK2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 5'-AMP-activated protein kinase subunit beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAB1, AMPK
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 5'-amp-activated protein kinase subunit gamma-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Prkag1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ezve1, d5ezve2
  • Chain 'F':
    Compound: 5'-amp-activated protein kinase subunit gamma-1
    Species: Homo sapiens [TaxId:9606]
    Gene: Prkag1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ezvf1, d5ezvf2
  • Heterogens: STU, C1V, C2Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ezvE (E:)
    madlnwetvissdsspavenehpqetpesnnsvytsfmkshrcydliptssklvvfdtsl
    qvkkaffalvtngvraaplwdskkqsfvgmltitdfinilhryyksalvqiyeleehkie
    twrevylqdsfkplvcispnaslfdavsslirnkihrlpvidpesgntlyilthkrilkf
    lklfitefpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekg
    rvvdiyskfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlvea
    evhrlvvvdendvvkgivslsdilqalvltggekkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ezvE (E:)
    snnsvytsfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfv
    gmltitdfinilhryyksalvqiyeleehkietwrevylqsfkplvcispnaslfdavss
    lirnkihrlpvidpesgntlyilthkrilkflklfitefpkpefmsksleelqigtyani
    amvrtttpvyvalgifvqhrvsalpvvdekgrvvdiyskfdvinlaaektynnldvsvtk
    alqhrshyfegvlkcylhetletiinrlveaevhrlvvvdendvvkgivslsdilqalvl
    tg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ezvF (F:)
    madlnwetvissdsspavenehpqetpesnnsvytsfmkshrcydliptssklvvfdtsl
    qvkkaffalvtngvraaplwdskkqsfvgmltitdfinilhryyksalvqiyeleehkie
    twrevylqdsfkplvcispnaslfdavsslirnkihrlpvidpesgntlyilthkrilkf
    lklfitefpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekg
    rvvdiyskfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlvea
    evhrlvvvdendvvkgivslsdilqalvltggekkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ezvF (F:)
    nnsvytsfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfvg
    mltitdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavss
    lirnkihrlpvidpesgntlyilthkrilkflklfitefpkpefmsksleelqigtyani
    amvrtttpvyvalgifvqhrvsalpvvdekgrvvdiyskfdvinlaaektynnldvsvtk
    alqhrshyfegvlkcylhetletiinrlveaevhrlvvvdendvvkgivslsdilqalvl