PDB entry 5ezp

View 5ezp on RCSB PDB site
Description: Human transthyretin (TTR) complexed with 4-hydroxy-chalcone
Class: transport protein
Keywords: Human transthyretin (TTR), chalcone, inhibitor complex, new crystal polymorph, transport protein
Deposited on 2015-11-26, released 2016-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ezpa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ezpb_
  • Chain 'C':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ezpc_
  • Chain 'D':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ezpd_
  • Chain 'E':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ezpe_
  • Chain 'F':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ezpf_
  • Chain 'G':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ezpg_
  • Chain 'H':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ezph_
  • Heterogens: IPJ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ezpA (A:)
    geskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefv
    egiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    ke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ezpA (A:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ezpB (B:)
    geskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefv
    egiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    ke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ezpB (B:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ezpC (C:)
    geskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefv
    egiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    ke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ezpC (C:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ezpD (D:)
    geskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefv
    egiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    ke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ezpD (D:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ezpE (E:)
    geskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefv
    egiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    ke
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ezpF (F:)
    geskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefv
    egiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    ke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ezpF (F:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ezpG (G:)
    geskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefv
    egiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    ke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ezpG (G:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ezpH (H:)
    geskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefv
    egiykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    ke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ezpH (H:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn