PDB entry 5ey3

View 5ey3 on RCSB PDB site
Description: X-ray structure of the thymidine phosphorylase from Salmonella typhimurium in complex with cytidine and sulphate
Class: transferase
Keywords: thymidine phosphorylase, nucleoside, metabolism, transferase
Deposited on 2015-11-24, released 2016-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidine phosphorylase
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: deoA, STM4568
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CP66 (2-441)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5ey3a1, d5ey3a2, d5ey3a3, d5ey3a4
  • Chain 'B':
    Compound: thymidine phosphorylase
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: deoA, STM4568
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ey3b1, d5ey3b2, d5ey3b3
  • Heterogens: SO4, GOL, EDO, CTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ey3A (A:)
    gsmflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervs
    ltmamrdsgtvldwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglg
    htggtldkleaipgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvd
    siplitgsilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttal
    ltdmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaeara
    klqavldngkaaevfgrmvaaqkgpsdfvenydkylptamlskavyadtegfisamdtra
    lgmavvsmgggrrqasdtidysvgftdmarlgdsidgqrplavihakdeaswqeaakavk
    aaiilddkapastpsvyrrite
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ey3B (B:)
    gsmflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervs
    ltmamrdsgtvldwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglg
    htggtldkleaipgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvd
    siplitgsilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttal
    ltdmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaeara
    klqavldngkaaevfgrmvaaqkgpsdfvenydkylptamlskavyadtegfisamdtra
    lgmavvsmgggrrqasdtidysvgftdmarlgdsidgqrplavihakdeaswqeaakavk
    aaiilddkapastpsvyrrite
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ey3B (B:)
    mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglght
    ggtldkleaipgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsi
    plitgsilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearakl
    qavldngkaaevfgrmvaaqkgpsdfvenydkylptamlskavyadtegfisamdtralg
    mavvsmgggrrqasdtidysvgftdmarlgdsidgqrplavihakdeaswqeaakavkaa
    iilddkapastpsvyrrite