PDB entry 5exf

View 5exf on RCSB PDB site
Description: Thermostable aldehyde dehydrogenase from Pyrobaculum sp.1860 complexed with NADP+
Class: oxidoreductase
Keywords: Aldehyde dehydrogenase, thermostable, oxidoreductase
Deposited on 2015-11-23, released 2016-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5exfa_
  • Chain 'B':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5exfb_
  • Chain 'C':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5exfc_
  • Chain 'D':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5exfd_
  • Chain 'E':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5exfe_
  • Chain 'F':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5exff_
  • Chain 'G':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5exfg_
  • Chain 'H':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum ferrireducens [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5exfh_
  • Heterogens: NAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5exfA (A:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exfA (A:)
    dlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkaw
    anipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelar
    hyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasd
    tpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaak
    aagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadk
    fieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgn
    ffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnra
    friaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtr
    rfpipsalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5exfB (B:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exfB (B:)
    kvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipa
    irraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgr
    vlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtg
    wliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtl
    ktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfiery
    vhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepa
    ifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriae
    avesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpip
    sal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5exfC (C:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exfC (C:)
    idlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealka
    wanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaela
    rhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpas
    dtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaa
    kaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavad
    kfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswg
    nffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnr
    afriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrt
    rrfpipsalk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5exfD (D:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exfD (D:)
    vanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipai
    rraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgrv
    lqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtgw
    liaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtlk
    tvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfieryv
    hyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepai
    fvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriaea
    vesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpips
    alk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5exfE (E:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exfE (E:)
    kvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipa
    irraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgr
    vlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtg
    wliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtl
    ktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfiery
    vhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepa
    ifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriae
    avesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpip
    sal
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5exfF (F:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exfF (F:)
    idlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealka
    wanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaela
    rhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpas
    dtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaa
    kaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavad
    kfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswg
    nffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnr
    afriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrt
    rrfpipsa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5exfG (G:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exfG (G:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psal
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5exfH (H:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5exfH (H:)
    nimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawan
    ipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhy
    qgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtp
    vtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaa
    gtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfi
    eryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnff
    epaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafr
    iaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrf
    pipsalk