PDB entry 5ewv
View 5ewv on RCSB PDB site
Description: Crystal structure of the human BRPF1 bromodomain in complex with SEED20
Class: DNA binding protein
Keywords: Bromodomain and PHD finger-containing protein 1(BRPF1), monocytic leukemia zinc-finger (MOZ), Inhibitor, transcription, DNA binding protein
Deposited on
2015-11-21, released
2016-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated
2016-11-02, with a file datestamp of
2016-10-28.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Peregrin
Species: Homo sapiens [TaxId:9606]
Gene: BRPF1, BR140
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5ewva_ - Heterogens: 5SN, NO3, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>5ewvA (A:)
smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
Sequence, based on observed residues (ATOM records): (download)
>5ewvA (A:)
emqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayr
ylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm