PDB entry 5eum

View 5eum on RCSB PDB site
Description: 1.8 Angstrom Crystal Structure of ATP-binding Component of Fused Lipid Transporter Subunits of ABC superfamily from Haemophilus influenzae.
Class: hydrolase
Keywords: ATP-binding domain, ABC transporter superfamily, CSGID, Structural Genomics, Center for Structural Genomics of Infectious Diseases, HYDROLASE
Deposited on 2015-11-18, released 2015-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipid A export ATP-binding/permease protein msbA
    Species: Haemophilus influenzae PittII [TaxId:374933]
    Gene: msbA, CGSHiII_09046
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5euma_
  • Chain 'B':
    Compound: Lipid A export ATP-binding/permease protein msbA
    Species: Haemophilus influenzae PittII [TaxId:374933]
    Gene: msbA, CGSHiII_09046
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5eumb_
  • Heterogens: ACT, SO4, MLI, SIN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5eumA (A:)
    snakddgaykaepakgelefknvsfayqgkeelalnnisfsvpagktvalvgrsgsgkst
    ianlvtrfydieqgeilldgvniqdyrlsnlrencavvsqqvhlfndtianniayaaqdk
    ysreeiiaaakaayalefieklpqgfdtvigengaslsggqrqrlaiarallrnspvlil
    deatsaldteseraiqsaleelkkdrtvvviahrlstienadeilvidhgeirergnhkt
    lleqngaykqlhsmqftg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eumA (A:)
    kddgaykaepakgelefknvsfayqgkeelalnnisfsvpagktvalvgrsgsgkstian
    lvtrfydieqgeilldgvniqdyrlsnlrencavvsqqvhlfndtianniayaaqdkysr
    eeiiaaakaayalefieklpqgfdtvigengaslsggqrqrlaiarallrnspvlildea
    tteseraiqsaleelkkdrtvvviahrlstienadeilvidhgeirergnhktlleqnga
    ykqlhsmqftg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5eumB (B:)
    snakddgaykaepakgelefknvsfayqgkeelalnnisfsvpagktvalvgrsgsgkst
    ianlvtrfydieqgeilldgvniqdyrlsnlrencavvsqqvhlfndtianniayaaqdk
    ysreeiiaaakaayalefieklpqgfdtvigengaslsggqrqrlaiarallrnspvlil
    deatsaldteseraiqsaleelkkdrtvvviahrlstienadeilvidhgeirergnhkt
    lleqngaykqlhsmqftg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eumB (B:)
    kddgaykaepakgelefknvsfayqgkeelalnnisfsvpagktvalvgrsgsgkstian
    lvtrfydieqgeilldgvniqdyrlsnlrencavvsqqvhlfndtianniaydkysreei
    iaaakaayalefieklpqgfdtvigengaslsggqrqrlaiarallrnspvlildeatte
    seraiqsaleelkkdrtvvviahrlstienadeilvidhgeirergnhktlleqngaykq
    lhsmqftg