PDB entry 5eth

View 5eth on RCSB PDB site
Description: RORy in complex with inverse agonist 3.
Class: transcription
Keywords: ROR gamma, Inverse Agonist, TRANSCRIPTION
Deposited on 2015-11-17, released 2016-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5etha_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ethb_
  • Heterogens: 5RT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ethA (A:)
    gplteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ethA (A:)
    eiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlteai
    qyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggmelf
    ralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynlel
    afhhhlckthrqsilaklppkgklrslcsqhverlqif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ethB (B:)
    gplteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ethB (B:)
    lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
    aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
    lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
    elafhhhlckthrqsilaklppkgklrslcsqhverlqifq