PDB entry 5esr

View 5esr on RCSB PDB site
Description: CRYSTAL STRUCTURE OF haloalkane dehalogenase (DccA) from Caulobacter crescentus
Class: hydrolase
Keywords: hydrolase
Deposited on 2015-11-17, released 2016-06-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haloalkane dehalogenase
    Species: Caulobacter crescentus (strain ATCC 19089 / CB15) [TaxId:190650]
    Gene: dhmA, CC_1175
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A919 (0-301)
      • expression tag (302-307)
    Domains in SCOPe 2.06: d5esra1, d5esra2
  • Heterogens: CO, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5esrA (A:)
    mdvlrtpderfegladwsfaphytevtdadgtalrihhvdegpkdqrpillmhgepsway
    lyrkviaelvakghrvvapdlvgfgrsdkpakrtdytyerhvawmsawleqndlkdivlf
    cqdwggliglrlvaafperfsavvvsntglpigvgksegfeawlnfsqntpelpvgfiln
    ggtardlsdaersaydapfpdesykegarifpalvpitpehasveenkaawavletfdkp
    fvtafsdadpitrggeamflarvpgtknvahttlkgghfvqedspveiaalldglvaglp
    qahhhhhh