PDB entry 5esa

View 5esa on RCSB PDB site
Description: Crystal structure of anti-HCV E2 antibody HC84-26
Class: immune system
Keywords: Hepatitis C virus, E2 glycoprotein, antibody, IMMUNE SYSTEM
Deposited on 2015-11-16, released 2016-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-HCV E2 glycoprotein Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5ESA (Start-216)
  • Chain 'B':
    Compound: Anti-HCV E2 glycoprotein Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5ESA
    Domains in SCOPe 2.07: d5esab1, d5esab2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5esaB (B:)
    msyvltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgipe
    rfsgsnsgntatltisrveagdeadyycqvwdsssvvfggwtkltvlradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5esaB (B:)
    syvltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssvvfggwtkltvlradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne