PDB entry 5eri

View 5eri on RCSB PDB site
Description: MarR Protein from Peptoclostridium difficile DA00132
Class: transcription
Keywords: Peptoclostridium difficile, MarR, Transcription factor, DNA-binding, TRANSCRIPTION
Deposited on 2015-11-14, released 2016-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MarR family Transcriptional regulator
    Species: Peptoclostridium difficile [TaxId:1496]
    Gene: yybA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A031WDA8 (21-End)
      • expression tag (15-20)
    Domains in SCOPe 2.07: d5eria1, d5eria2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5eriA (A:)
    gsshhhhhhssglvprgshmliktldsnilrevgtlsravnsindikykelklqkgqftf
    ltricenpginlvelsnmlkvdkatttkaiqklikagyvdkkqdkfdkrgynltptdksl
    evyeliieeenrsieicfdnftdeekqvvtkllekmsknvenewfkvkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eriA (A:)
    rgshmliktldsnilrevgtlsravnsindikykelklqkgqftfltricenpginlvel
    snmlkvdkatttkaiqklikagyvdkkqdkfdkrgynltptdkslevyeliieeenrsie
    icfdnftdeekqvvtkllekmsknvenewfkvk