PDB entry 5epc

View 5epc on RCSB PDB site
Description: Crystal structure of wild-type human phosphoglucomutase 1
Class: isomerase
Keywords: isomerase metabolism, ISOMERASE
Deposited on 2015-11-11, released 2016-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (23-584)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d5epca1, d5epca2, d5epca3, d5epca4, d5epca5
  • Chain 'B':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (23-584)
      • expression tag (22)
    Domains in SCOPe 2.07: d5epcb1, d5epcb2, d5epcb3, d5epcb4, d5epcb5
  • Heterogens: MG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5epcA (A:)
    mhhhhhhssgvdlgtenlyfqsnmvkivtvktqayqdqkpgtsglrkrvkvfqssanyae
    nfiqsiistvepaqrqeatlvvggdgrfymkeaiqliariaaangigrlvigqngilstp
    avsciirkikaiggiiltashnpggpngdfgikfnisnggpapeaitdkifqisktieey
    avcpdlkvdlgvlgkqqfdlenkfkpftveivdsveayatmlrsifdfsalkellsgpnr
    lkiridamhgvvgpyvkkilceelgapansavncvpledfgghhpdpnltyaadlvetmk
    sgehdfgaafdgdgdrnmilgkhgffvnpsdsvaviaanifsipyfqqtgvrgfarsmpt
    sgaldrvasatkialyetptgwkffgnlmdasklslcgeesfgtgsdhirekdglwavla
    wlsilatrkqsvedilkdhwqkygrnfftrydyeeveaegankmmkdlealmfdrsfvgk
    qfsandkvytvekadnfeysdpvdgsisrnqglrliftdgsrivfrlsgtgsagatirly
    idsyekdvakinqdpqvmlaplisialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5epcA (A:)
    snmvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlv
    vggdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltash
    npggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdle
    nkfkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilc
    eelgapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilg
    khgffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptg
    wkffgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwq
    kygrnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysd
    pvdgsisrnqglrliftdgsrivfrlsgagatirlyidsyekdvakinqdpqvmlaplis
    ialkvsqlqertgrtaptvit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5epcB (B:)
    mhhhhhhssgvdlgtenlyfqsnmvkivtvktqayqdqkpgtsglrkrvkvfqssanyae
    nfiqsiistvepaqrqeatlvvggdgrfymkeaiqliariaaangigrlvigqngilstp
    avsciirkikaiggiiltashnpggpngdfgikfnisnggpapeaitdkifqisktieey
    avcpdlkvdlgvlgkqqfdlenkfkpftveivdsveayatmlrsifdfsalkellsgpnr
    lkiridamhgvvgpyvkkilceelgapansavncvpledfgghhpdpnltyaadlvetmk
    sgehdfgaafdgdgdrnmilgkhgffvnpsdsvaviaanifsipyfqqtgvrgfarsmpt
    sgaldrvasatkialyetptgwkffgnlmdasklslcgeesfgtgsdhirekdglwavla
    wlsilatrkqsvedilkdhwqkygrnfftrydyeeveaegankmmkdlealmfdrsfvgk
    qfsandkvytvekadnfeysdpvdgsisrnqglrliftdgsrivfrlsgtgsagatirly
    idsyekdvakinqdpqvmlaplisialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5epcB (B:)
    nmvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvv
    ggdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashn
    pggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlen
    kfkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilce
    elgapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgk
    hgffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgw
    kffgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqk
    ygrnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdp
    vdgsisrnqglrliftdgsrivfrlsatirlyidsyekdvakinqdpqvmlaplisialk
    vsqlqertgrtaptvit