PDB entry 5ep8

View 5ep8 on RCSB PDB site
Description: X-Ray Structure of the Complex Pyrimidine-nucleoside phosphorylase from Bacillus subtilis with Sulfate Ion
Class: transferase
Keywords: Transferase, Pyrimidine-nucleoside phosphorylase, NP-2 superfamily
Deposited on 2015-11-11, released 2016-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyrimidine-nucleoside phosphorylase
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Gene: pdp, BSU39400
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39142 (0-432)
      • conflict (47)
      • conflict (127)
      • conflict (136)
    Domains in SCOPe 2.07: d5ep8a1, d5ep8a2, d5ep8a3
  • Chain 'B':
    Compound: Pyrimidine-nucleoside phosphorylase
    Species: BACILLUS SUBTILIS SUBSP. SUBTILIS STR. 168 [TaxId:224308]
    Gene: pdp, BSU39400
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39142 (0-432)
      • conflict (47)
      • conflict (127)
      • conflict (136)
    Domains in SCOPe 2.07: d5ep8b1, d5ep8b2, d5ep8b3
  • Heterogens: SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ep8A (A:)
    mrmvdiiikkqngkeltteeiqffvngytdgsipdyqasalamaiffrdmsdreradltm
    amvnsgetidlsaiegikvdkhstggvgdtttlvlaplvaaldvpvakmsgrglghtggt
    idkleaidgfhveltkrefiklvnrdkvavigqsgnltpadkklyalrdvtgtvnsipli
    assimskkiaagadaivldvktgagafmkteedaaelakamvrignnvgrqtmavisdms
    qplgfaignalevkeaidtlkgegpedlhelvltlgsqmvvlakkadtldearakleevm
    kngkalekfkdflknqggdssivddpsklpqaayqidvpakeagvvseivadeigvaaml
    lgagratkedeidlavgimlrkkvgdkvekgeplvtlyanrenvdeviakvydniriaae
    akapklihtlite
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ep8B (B:)
    mrmvdiiikkqngkeltteeiqffvngytdgsipdyqasalamaiffrdmsdreradltm
    amvnsgetidlsaiegikvdkhstggvgdtttlvlaplvaaldvpvakmsgrglghtggt
    idkleaidgfhveltkrefiklvnrdkvavigqsgnltpadkklyalrdvtgtvnsipli
    assimskkiaagadaivldvktgagafmkteedaaelakamvrignnvgrqtmavisdms
    qplgfaignalevkeaidtlkgegpedlhelvltlgsqmvvlakkadtldearakleevm
    kngkalekfkdflknqggdssivddpsklpqaayqidvpakeagvvseivadeigvaaml
    lgagratkedeidlavgimlrkkvgdkvekgeplvtlyanrenvdeviakvydniriaae
    akapklihtlite