PDB entry 5ene

View 5ene on RCSB PDB site
Description: Crystal structure of the second bromodomain of Pleckstrin homology domain interacting protein (PHIP) in complex with 5-Amino-2-benzyl-1,3-oxazole-4-carbonitrile (SGC - Diamond I04-1 fragment screening)
Class: signaling protein
Keywords: bromodomain, PHIP, crystallographic fragment screen, transcription, Structural Genomics, Structural Genomics Consortium, SGC, signaling protein
Deposited on 2015-11-09, released 2016-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PH-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PHIP, WDR11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WWQ0 (5-End)
      • expression tag (3-4)
    Domains in SCOPe 2.06: d5enea1, d5enea2
  • Heterogens: 5Q8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5eneA (A:)
    yfqsmsydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvret
    leagnyespmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksal
    rfhkrntitkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5eneA (A:)
    smsydiqawkkqceellnlifqcedsepfrqpvdlleypdyrdiidtpmdfatvretlea
    gnyespmelckdvrlifsnskaytpskrsriysmslrlsaffeehissvlsdyksalrfh
    krn