PDB entry 5en2

View 5en2 on RCSB PDB site
Description: Molecular basis for antibody-mediated neutralization of New World hemorrhagic fever mammarenaviruses
Class: viral protein/immune system
Keywords: Immunoglobulin, glycoprotein, virus, complex, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2015-11-09, released 2015-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GD01 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5EN2 (0-223)
  • Chain 'B':
    Compound: GD01 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5EN2 (0-211)
    Domains in SCOPe 2.07: d5en2b1, d5en2b2
  • Chain 'C':
    Compound: Pre-glycoprotein polyprotein GP complex
    Species: Junin mammarenavirus [TaxId:11619]
    Gene: GPC, GP-C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5en2B (B:)
    divmtqsqkfmstsigdrvsitckasqnvgsavawyqqkpgqspklliysasnrytgvpd
    rfigsesgtdftltisnmqsedladyfcqqyssyplafgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    No sequence available.