PDB entry 5emz

View 5emz on RCSB PDB site
Description: Crystal structure of K48-linked diubiquitin with F45W mutation in the proximal unit
Class: signaling protein
Keywords: ubiquitin signaling, multidomain system, fluorescence assay, SIGNALING PROTEIN
Deposited on 2015-11-07, released 2016-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-75)
      • conflict (47)
    Domains in SCOPe 2.06: d5emza_
  • Chain 'B':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-End)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d5emzb_
  • Chain 'C':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-75)
      • conflict (47)
    Domains in SCOPe 2.06: d5emzc_
  • Chain 'D':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-End)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d5emzd_
  • Chain 'E':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-75)
      • conflict (47)
    Domains in SCOPe 2.06: d5emze_
  • Chain 'F':
    Compound: Polyubiquitin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-End)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d5emzf_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5emzA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5emzB (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrliwagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5emzB (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrliwagkqledgrtlsdyn
    iqkestlhlvlrlr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5emzC (C:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5emzD (D:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrliwagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5emzD (D:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrliwagkqledgrtlsdyn
    iqkestlhlvlrl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5emzE (E:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5emzF (F:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrliwagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5emzF (F:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrliwagkqledgrtlsdyn
    iqkestlhlvlrl