PDB entry 5em1

View 5em1 on RCSB PDB site
Description: Crystal structure of ragweed allergen Amb a 8
Class: allergen
Keywords: Allergen
Deposited on 2015-11-05, released 2016-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Profilin
    Species: Ambrosia artemisiifolia [TaxId:4212]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2KN24 (3-134)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d5em1a1, d5em1a2
  • Heterogens: BEZ, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5em1A (A:)
    gsgswqtyvdehlmcdiegtgqhlasaaifgtdgnvwaksssfpefkpdeinaiikefse
    pgalaptglflagakymviqgepgavirgkkgaggicikktgqamvfgiyeepvnpgqcn
    mvverlgdylvdqgm