PDB entry 5elx

View 5elx on RCSB PDB site
Description: S. cerevisiae Dbp5 bound to RNA and mant-ADP BeF3
Class: hydrolase
Keywords: Fluorescent, Nucleotide, Mant, ADP, RNA helicase, HYDROLASE
Deposited on 2015-11-05, released 2016-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase DBP5
    Species: Saccharomyces cerevisiae (strain YJM789) [TaxId:307796]
    Gene: DBP5, RAT8, SCY_5119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5elxa1, d5elxa2
  • Chain 'B':
    Compound: RNA (5'-r(p*up*up*up*up*up*u)-3')
    Species: Saccharomyces cerevisiae (strain YJM789) [TaxId:307796]
  • Heterogens: M2A, MG, BEF, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5elxA (A:)
    aksfdelglapellkgiyamkfqkpskiqeralplllhnpprnmiaqsqsgtgktaafsl
    tmltrvnpedaspqaiclapsrelarqtlevvqemgkftkitsqlivpdsfeknkqinaq
    vivgtpgtvldlmrrklmqlqkikifvldeadnmldqqglgdqcirvkrflpkdtqlvlf
    satfadavrqyakkivpnantlelqtnevnvdaikqlymdckneadkfdvltelyglmti
    gssiifvatkktanvlygklkseghevsilhgdlqtqerdrliddfregrskvlittnvl
    argidiptvsmvvnydlptlangqadpatyihrigrtgrfgrkgvaisfvhdknsfnils
    aiqkyfgdiemtrvptddwdevekivkkvlk
    

  • Chain 'B':
    No sequence available.