PDB entry 5elb
View 5elb on RCSB PDB site
Description: Cholera toxin classical B-pentamer in complex with Lewis-y
Class: toxin
Keywords: Cholera toxin B-pentamer, Lewis-y, complex, blood group oligosaccharide/antigen, toxin
Deposited on
2015-11-04, released
2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-11, with a file datestamp of
2017-10-06.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.75
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae [TaxId:666]
Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5elba_ - Chain 'B':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae [TaxId:666]
Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5elbb_ - Chain 'C':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae [TaxId:666]
Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5elbc_ - Chain 'D':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae [TaxId:666]
Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5elbd_ - Chain 'E':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae [TaxId:666]
Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5elbe_ - Chain 'F':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae [TaxId:666]
Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5elbf_ - Chain 'G':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae [TaxId:666]
Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5elbg_ - Chain 'H':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae [TaxId:666]
Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5elbh_ - Chain 'I':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae [TaxId:666]
Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5elbi_ - Chain 'J':
Compound: Cholera enterotoxin B subunit
Species: Vibrio cholerae [TaxId:666]
Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d5elbj_ - Heterogens: CA, GAL, GLA, BCN, NDG, FUC, PEG, NAG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5elbA (A:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5elbB (B:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>5elbC (C:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>5elbD (D:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>5elbE (E:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>5elbF (F:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>5elbG (G:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>5elbH (H:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>5elbI (I:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
- Chain 'J':
Sequence; same for both SEQRES and ATOM records: (download)
>5elbJ (J:)
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman