PDB entry 5elb

View 5elb on RCSB PDB site
Description: Cholera toxin classical B-pentamer in complex with Lewis-y
Class: toxin
Keywords: Cholera toxin B-pentamer, Lewis-y, complex, blood group oligosaccharide/antigen, toxin
Deposited on 2015-11-04, released 2016-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elba_
  • Chain 'B':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elbb_
  • Chain 'C':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elbc_
  • Chain 'D':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elbd_
  • Chain 'E':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elbe_
  • Chain 'F':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elbf_
  • Chain 'G':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elbg_
  • Chain 'H':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elbh_
  • Chain 'I':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elbi_
  • Chain 'J':
    Compound: Cholera enterotoxin B subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: ctxB, EN12_07055, ERS013160_03498, ERS013165_03981, ERS013197_06217, ERS013202_03762, ERS013206_03003, ERS013207_03244, ERS013212_03447
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5elbj_
  • Heterogens: CA, GAL, GLA, BCN, NDG, FUC, PEG, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5elbA (A:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5elbB (B:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5elbC (C:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5elbD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5elbE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5elbF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5elbG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5elbH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5elbI (I:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5elbJ (J:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman