PDB entry 5ek6

View 5ek6 on RCSB PDB site
Description: Thermostable aldehyde dehydrogenase from Pyrobaculum sp. 1860 complexed with NADP and isobutyraldehyde
Class: oxidoreductase
Keywords: Thermostable aldehyde dehydrogenase, oxidoreductase
Deposited on 2015-11-03, released 2016-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ek6a_
  • Chain 'B':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ek6b_
  • Chain 'C':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ek6c_
  • Chain 'D':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ek6d_
  • Chain 'E':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ek6e_
  • Chain 'F':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ek6f_
  • Chain 'G':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ek6g_
  • Chain 'H':
    Compound: aldehyde dehydrogenase
    Species: Pyrobaculum sp. 1860 [TaxId:1104324]
    Gene: P186_1147
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ek6h_
  • Heterogens: NAP, 5OZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ek6A (A:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ek6A (A:)
    vanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipai
    rraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgrv
    lqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtgw
    liaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtlk
    tvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfieryv
    hyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepai
    fvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriaea
    vesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpips
    alk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ek6B (B:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ek6B (B:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ek6C (C:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ek6C (C:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psalk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ek6D (D:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ek6D (D:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psalk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ek6E (E:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ek6E (E:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psalk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ek6F (F:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ek6F (F:)
    vanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipai
    rraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgrv
    lqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtgw
    liaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtlk
    tvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfieryv
    hyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepai
    fvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriaea
    vesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpips
    alk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ek6G (G:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ek6G (G:)
    mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip
    airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg
    rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt
    gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt
    lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier
    yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep
    aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria
    eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi
    psal
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ek6H (H:)
    midlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealk
    awanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaael
    arhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpa
    sdtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreia
    akaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkava
    dkfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrsw
    gnffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvn
    rafriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlr
    trrfpipsalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ek6H (H:)
    vanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipai
    rraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgrv
    lqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtgw
    liaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtlk
    tvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfieryv
    hyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepai
    fvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriaea
    vesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpips
    alk