PDB entry 5ei5

View 5ei5 on RCSB PDB site
Description: Crystal structure of MSF-aged Torpedo californica Acetylcholinesterase in complex with alkylene-linked bis-tacrine dimer (7 carbon linker)
Class: hydrolase
Keywords: alpha beta hydrolase, irreversible inhibitor, hydrolase
Deposited on 2015-10-29, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Torpedo californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ei5a_
  • Heterogens: NAG, 03S, AA7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ei5A (A:)
    dhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnas
    typnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfy
    sgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvh
    dniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaeg
    rrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeff
    ptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvp
    handlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyly
    ffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgn
    pnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat