PDB entry 5egn

View 5egn on RCSB PDB site
Description: Est816 as an N-Acyl homoserine lactone degrading enzyme
Class: hydrolase
Keywords: N-acyl-homoserine lactone, lactonase, quorum-sensing, thermostability, HYDROLASE
Deposited on 2015-10-27, released 2016-11-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: est816
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6YRG4 (Start-260)
      • engineered mutation (215)
      • engineered mutation (237)
    Domains in SCOPe 2.06: d5egna_
  • Chain 'B':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: est816
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6YRG4 (Start-260)
      • engineered mutation (215)
      • engineered mutation (237)
    Domains in SCOPe 2.06: d5egnb_
  • Chain 'C':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: est816
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6YRG4
      • engineered mutation (215)
      • engineered mutation (237)
    Domains in SCOPe 2.06: d5egnc_
  • Chain 'D':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: est816
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6YRG4
      • engineered mutation (215)
      • engineered mutation (237)
    Domains in SCOPe 2.06: d5egnd_
  • Chain 'E':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: est816
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6YRG4
      • engineered mutation (215)
      • engineered mutation (237)
    Domains in SCOPe 2.06: d5egne_
  • Chain 'F':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: est816
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6YRG4 (Start-260)
      • engineered mutation (215)
      • engineered mutation (237)
    Domains in SCOPe 2.06: d5egnf_
  • Chain 'G':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: est816
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6YRG4
      • engineered mutation (215)
      • engineered mutation (237)
    Domains in SCOPe 2.06: d5egng_
  • Chain 'H':
    Compound: esterase
    Species: Uncultured bacterium [TaxId:77133]
    Gene: est816
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6YRG4
      • engineered mutation (215)
      • engineered mutation (237)
    Domains in SCOPe 2.06: d5egnh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5egnA (A:)
    mphvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsd
    kpatgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgt
    glgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvf
    daatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindv
    ghfyqlerpsefnellrgfvaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5egnA (A:)
    phvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsdk
    patgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgtg
    lgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvfd
    aatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindvg
    hfyqlerpsefnellrgfva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5egnB (B:)
    mphvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsd
    kpatgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgt
    glgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvf
    daatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindv
    ghfyqlerpsefnellrgfvaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5egnB (B:)
    phvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsdk
    patgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgtg
    lgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvfd
    aatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindvg
    hfyqlerpsefnellrgfva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5egnC (C:)
    mphvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsd
    kpatgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgt
    glgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvf
    daatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindv
    ghfyqlerpsefnellrgfvaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5egnC (C:)
    phvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsdk
    patgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgtg
    lgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvfd
    aatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindvg
    hfyqlerpsefnellrgfv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5egnD (D:)
    mphvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsd
    kpatgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgt
    glgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvf
    daatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindv
    ghfyqlerpsefnellrgfvaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5egnD (D:)
    phvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsdk
    patgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgtg
    lgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvfd
    aatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindvg
    hfyqlerpsefnellrgfv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5egnE (E:)
    mphvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsd
    kpatgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgt
    glgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvf
    daatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindv
    ghfyqlerpsefnellrgfvaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5egnE (E:)
    phvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsdk
    patgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgtg
    lgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvfd
    aatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindvg
    hfyqlerpsefnellrgfv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5egnF (F:)
    mphvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsd
    kpatgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgt
    glgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvf
    daatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindv
    ghfyqlerpsefnellrgfvaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5egnF (F:)
    phvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsdk
    patgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgtg
    lgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvfd
    aatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindvg
    hfyqlerpsefnellrgfva
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5egnG (G:)
    mphvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsd
    kpatgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgt
    glgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvf
    daatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindv
    ghfyqlerpsefnellrgfvaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5egnG (G:)
    phvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsdk
    patgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgtg
    lgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvfd
    aatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindvg
    hfyqlerpsefnellrgfv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5egnH (H:)
    mphvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsd
    kpatgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgt
    glgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvf
    daatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindv
    ghfyqlerpsefnellrgfvaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5egnH (H:)
    phvendgvkiyydsygegvpivflhpfstnggiwyfqtfpfaqtnhvividhrghgrsdk
    patgysimehaddvvavldalkvdravfvgnsiggmiamqlnldhpqrvignlilssgtg
    lgegmppeagaafqndyigafggllegavsarskrerpeilavmkahfsvpsnfpkhvfd
    aatadpngvfawnikdrlssiqaptlvvageedlvttvannqlladnipgaelrvindvg
    hfyqlerpsefnellrgf