PDB entry 5efq

View 5efq on RCSB PDB site
Description: Crystal structure of human Cdk13/Cyclin K in complex with ADP-aluminum fluoride
Class: transferase
Keywords: kinase, cyclin, ADP, transferase
Deposited on 2015-10-24, released 2015-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclin-dependent kinase 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK13, CDC2L, CDC2L5, CHED, KIAA1791
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5efqa_
  • Chain 'B':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNK, CPR4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5efqb1, d5efqb2
  • Chain 'C':
    Compound: Cyclin-dependent kinase 13
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK13, CDC2L, CDC2L5, CHED, KIAA1791
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5efqc_
  • Chain 'D':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNK, CPR4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5efqd1, d5efqd2
  • Heterogens: ADP, AF3, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5efqA (A:)
    gdidwgkrcvdkfdiigiigegtygqvykardkdtgemvalkkvrldnekegfpitaire
    ikilrqlthqsiinmkeivtdkedaldfkkdkgafylvfeymdhdlmgllesglvhfnen
    hiksfmrqlmegldychkknflhrdikcsnillnnrgqikladfglarlysseesrpytn
    kvitlwyrppelllgeerytpaidvwscgcilgelftkkpifqanqelaqlelisricgs
    pcpavwpdviklpyfntmkpkkqyrrklreefvfipaaaldlfdymlaldpskrctaeqa
    lqceflrdvepskmpppdlplwqdchelwskkrrrqkqmgmtddvst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5efqA (A:)
    idwgkrcvdkfdiigiigegtygqvykardkdtgemvalkkvrldnekegfpitaireik
    ilrqlthqsiinmkeivtdkegafylvfeymdhdlmgllesglvhfnenhiksfmrqlme
    gldychkknflhrdikcsnillnnrgqikladfglarlysseesrpytnkvitlwyrppe
    lllgeerytpaidvwscgcilgelftkkpifqanqelaqlelisricgspcpavwpdvik
    lpyfntmkpkkqyrrklreefvfipaaaldlfdymlaldpskrctaeqalqceflrdvep
    skmpppdlplwqdchelwskkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5efqB (B:)
    gmkenkensspsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifd
    vgtrlglhydtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiikt
    arsllndvqfgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiq
    klvqmawtfvndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfv
    qdvpvdvledichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5efqB (B:)
    kpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhr
    fymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeev
    mvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslq
    wepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysq
    gk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5efqC (C:)
    gdidwgkrcvdkfdiigiigegtygqvykardkdtgemvalkkvrldnekegfpitaire
    ikilrqlthqsiinmkeivtdkedaldfkkdkgafylvfeymdhdlmgllesglvhfnen
    hiksfmrqlmegldychkknflhrdikcsnillnnrgqikladfglarlysseesrpytn
    kvitlwyrppelllgeerytpaidvwscgcilgelftkkpifqanqelaqlelisricgs
    pcpavwpdviklpyfntmkpkkqyrrklreefvfipaaaldlfdymlaldpskrctaeqa
    lqceflrdvepskmpppdlplwqdchelwskkrrrqkqmgmtddvst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5efqC (C:)
    wgkrcvdkfdiigiigegtygqvykardkdtgemvalkkvrldnekegfpitaireikil
    rqlthqsiinmkeivtdkegafylvfeymdhdlmgllesglvhfnenhiksfmrqlmegl
    dychkknflhrdikcsnillnnrgqikladfglarlysseesrpytnkvitlwyrppell
    lgeerytpaidvwscgcilgelftkkpifqanqelaqlelisricgspcpavwpdviklp
    yfntmkpkkqyrrklreefvfipaaaldlfdymlaldpskrctaeqalqceflrdvepsk
    mpppdlplwqdchelwskkrrrqkqm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5efqD (D:)
    gmkenkensspsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifd
    vgtrlglhydtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiikt
    arsllndvqfgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiq
    klvqmawtfvndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfv
    qdvpvdvledichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >5efqD (D:)
    kpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhr
    fymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeev
    mvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslq
    wepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlys