PDB entry 5ee3

View 5ee3 on RCSB PDB site
Description: complex structure of osychf1 with amp-pnp
Class: hydrolase
Keywords: osychf1, GTP-BINDING PROTEIN, ATP, AMP-PNP, YchF-type, P-Loop NTPase, HYDROLASE
Deposited on 2015-10-22, released 2016-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Obg-like ATPase 1
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: OS08G0199300, OSYCHF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ee3a1, d5ee3a2
  • Chain 'B':
    Compound: Obg-like ATPase 1
    Species: Oryza sativa subsp. japonica [TaxId:39947]
    Gene: OS08G0199300, OSYCHF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ee3b1, d5ee3b2
  • Heterogens: ANP, MG, CL, EPE, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ee3A (A:)
    smppkaskkdaapaerpilgrfsshlkigivglpnvgkstffnivtklsipaenfpfcti
    dpnearvyvpderfdwlcqlykpksevsayleindiaglvrgahageglgnaflshirav
    dgifhvlrafedkevthiddsvdpvrdletigeelrlkdiefvqnkiddleksmkrsndk
    qlklehelcekvkahledgkdvrfgdwksadieilntfqlltakpvvylvnmsekdyqrk
    knkflpkihawvqehggetiipfscaferlladmppdeaakycaenqiasvipkiiktgf
    aaihliyfftagpdevkcwqirrqtkapqaagtihtdfergficaevmkfddlkelgses
    avkaagkyrqegktyvvqdgdiiffkfnvsgggkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ee3A (A:)
    erpilgrfsshlkigivglpnvgkstffnivtklsipaenfpfctidpnearvyvpderf
    dwlcqlykpksevsayleindialgnaflshiravdgifhvlrafedkdsvdpvrdleti
    geelrlkdiefvqnkiddleksmkrsndkqlklehelcekvkahledgkdvrfgdwksad
    ieilntfqlltakpvvylvnmsekdyqrkknkflpkihawvqehggetiipfscaferll
    admppdeaakycaenqiasvipkiiktgfaaihliyfftagpdevkcwqirrqtkapqaa
    gtihtdfergficaevmkfddlkelgsesavkaagkyrqegktyvvqdgdiiffkfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ee3B (B:)
    smppkaskkdaapaerpilgrfsshlkigivglpnvgkstffnivtklsipaenfpfcti
    dpnearvyvpderfdwlcqlykpksevsayleindiaglvrgahageglgnaflshirav
    dgifhvlrafedkevthiddsvdpvrdletigeelrlkdiefvqnkiddleksmkrsndk
    qlklehelcekvkahledgkdvrfgdwksadieilntfqlltakpvvylvnmsekdyqrk
    knkflpkihawvqehggetiipfscaferlladmppdeaakycaenqiasvipkiiktgf
    aaihliyfftagpdevkcwqirrqtkapqaagtihtdfergficaevmkfddlkelgses
    avkaagkyrqegktyvvqdgdiiffkfnvsgggkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ee3B (B:)
    erpilgrfsshlkigivglpnvgkstffnivtklsipaenfpfctidpnearvyvpderf
    dwlcqlykpksevsayleindiaglvrgeglgnaflshiravdgifhvlrafedkdsvdp
    vrdletigeelrlkdiefvqnkiddleksmkrsndkqlklehelcekvkahledgkdvrf
    gdwksadieilntfqlltakpvvylvnmsekdyqrkknkflpkihawvqehggetiipfs
    caferlladmppdeaakycaenqiasvipkiiktgfaaihliyfftagpdevkcwqirrq
    tkapqaagtihtdfergficaevmkfddlkelgsesavkaagkyrqegktyvvqdgdiif
    fkfn