PDB entry 5edt

View 5edt on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis CYP121 in complex with LIG9
Class: oxidoreductase
Keywords: cytochrome P450, CYP121, Mycobacterium tuberculosis, fragment-based drug discovery, OXIDOREDUCTASE
Deposited on 2015-10-22, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 121
    Species: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) [TaxId:233413]
    Gene: cyp121, Mb2299
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5edta_
  • Heterogens: HEM, 5MK, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5edtA (A:)
    tatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfs
    mketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansll
    dnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakin
    wdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsf
    lttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrk
    gelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigiea
    llkkmpgvdlavpidqlvwrtrfqrriperlpvlw