PDB entry 5eds

View 5eds on RCSB PDB site
Description: Crystal structure of human PI3K-gamma in complex with benzimidazole inhibitor 5
Class: Transferase/Transferase Inhibitor
Keywords: Inhibitor, phosphotransferase, p110, Transferase-Transferase Inhibitor complex
Deposited on 2015-10-21, released 2015-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5edsa1, d5edsa2, d5edsa3, d5edsa4
  • Heterogens: SO4, 5MT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5edsA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
    sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeew
    plvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvfv
    eaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapalss
    kasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadklt
    satnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatdp
    lnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsald
    vgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfllk
    rglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqviemlq
    kvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekckv
    maskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldlc
    llpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfqa
    averfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginkerv
    pfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpqlt
    skedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5edsA (A:)
    sqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtskp
    lpeylwkkianncifivihrsttsqtikvspddtpgailqsdfvlrvcgrdeylvgetpi
    knfqwvrhclkngeeihvvldtppdpaldevrkevslwdcdrkfrvkirgidipvldltv
    fveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiyckvqlly
    yvnlllidhrfllrrgeyvlhmwqissfnadkltsatnpdkensmsisilldpialpkhe
    mpnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivak
    tyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqa
    vkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgt
    amlhdftqqvqviemlqkvtldikslsavssqvisqlkqklenlqnsqlpesfrvpydpg
    lkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilri
    mesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgafkdevlnhwlke
    kspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghkervpf
    vltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpqltsk
    edieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwfl