PDB entry 5eca

View 5eca on RCSB PDB site
Description: Crystal structure of a chimeric c-Src-SH3 domain with the sequence of the RT-loop from the Abl-SH3 domain at pH 6.5
Class: transferase
Keywords: beta shandwich, transferase
Deposited on 2015-10-20, released 2016-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (3-59)
      • expression tag (0-2)
      • engineered mutation (11-13)
      • conflict (14)
      • engineered mutation (46)
    Domains in SCOPe 2.06: d5ecaa1, d5ecaa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ecaA (A:)
    shmtfvalydyvasgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvapsd