PDB entry 5e9m

View 5e9m on RCSB PDB site
Description: Crystal Structure of BAZ2B bromodomain in complex with N-methyltrimethylacetamide
Class: transcription
Keywords: four helical bundle, transcription
Deposited on 2015-10-15, released 2016-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-115)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5e9ma1, d5e9ma2
  • Heterogens: BAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5e9mA (A:)
    smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
    eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv