PDB entry 5e8h

View 5e8h on RCSB PDB site
Description: Crystal structure of geranylfarnesyl pyrophosphate synthases 2 from Arabidopsis thaliana
Class: transferase
Keywords: GFPPS, prenyltransferase, TRANSFERASE
Deposited on 2015-10-14, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl pyrophosphate synthase 3, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GGPP3, At3g14550, MIE1.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e8ha_
  • Chain 'B':
    Compound: Geranylgeranyl pyrophosphate synthase 3, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: GGPP3, At3g14550, MIE1.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e8hb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e8hA (A:)
    msaltsqggrdmippegkcndhnsafdfklymirkaesvnaaldvsvplrepltvqeavr
    ysllaggkrvrpllciavcelvggdeatamsaacavemihtsslihddlpcmdnadlrrg
    kptnhkvygedmavlagdallalafehmtvvssglvapermiravvelaraigttglvag
    qmidlaserlnpdkvglehlefihlhktaalleaaavlgvimgggteeeieklrkyarci
    gllfqvvddildvtksteelgktagkdvmagkltyprliglerskevaeklrreaeeqll
    gfdpskaaplvalasyiacrhnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e8hA (A:)
    cndhnsafdfklymirkaesvnaaldvsvplrepltvqeavrysllaggkrvrpllciav
    celvggdeatamsaacavemihtsslihddlpcmdnadlrrgkptnhkvygedmavlagd
    allalafehmtvvssglvapermiravvelaraigttglvagqmidlglehlefihlhkt
    aalleaaavlgvimgggteeeieklrkyarcigllfqvvddildvtksteeltyprligl
    erskevaeklrreaeeqllgfdpskaaplvalasyiac
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e8hB (B:)
    msaltsqggrdmippegkcndhnsafdfklymirkaesvnaaldvsvplrepltvqeavr
    ysllaggkrvrpllciavcelvggdeatamsaacavemihtsslihddlpcmdnadlrrg
    kptnhkvygedmavlagdallalafehmtvvssglvapermiravvelaraigttglvag
    qmidlaserlnpdkvglehlefihlhktaalleaaavlgvimgggteeeieklrkyarci
    gllfqvvddildvtksteelgktagkdvmagkltyprliglerskevaeklrreaeeqll
    gfdpskaaplvalasyiacrhnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e8hB (B:)
    hnsafdfklymirkaesvnaaldvsvplrepvqeavrysllaggkrvrpllciavcelvg
    gdeatamsaacavemihtsslihddlpcmdnadlrrgkptnhkvygedmavlagdallal
    afehmtvvssglvapermiravvelaraigttglvagqmidlavglehlefihlhktaal
    leaaavlgvimgggteeeieklrkyarcigllfqvvddildvltyprliglerskevaek
    lrreaeeqllgfdpskaaplvalasyiacr