PDB entry 5e8e

View 5e8e on RCSB PDB site
Description: Crystal structure of thrombin bound to an exosite 1-specific IgA Fab
Class: immune system/hydrolase
Keywords: immune system-hydrolase complex, immune system, inhibitor
Deposited on 2015-10-14, released 2015-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iga fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5E8E (0-214)
    Domains in SCOPe 2.08: d5e8ea1, d5e8ea2
  • Chain 'B':
    Compound: iga fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5E8E (0-228)
    Domains in SCOPe 2.08: d5e8eb1, d5e8eb2
  • Chain 'H':
    Compound: Thrombin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Thrombin light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PEG, PO4, CIT, NA, 0G6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5e8eA (A:)
eivltqspatlslspgeratlscrasqnvssflawyqhkpgqaprlliydassratdipi
rfsgsgsgtdftltisglepedfavyycqqrrswppltfgggtkveikrtvaapsvfifp
psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
tlskadyekqkvyacevthqglsspvtksflrgec

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5e8eB (B:)
evqliqsgsavkkpgasvrvsckvsgytlteaaihwvrqapgkglewmggldpqdgetvy
aqqfkgrvtmtedrstdtaymevnnlrsedtatyycttgdfsefepfsmdyfhfwgqgtv
vtvasstpvspkvfplslcstqpdgnvviaclvqgffpqeplsvtwsesgqgvtarnfpp
sqdasgdlyttssqltlpatqclagksvtchvkhytnpsqdvtvpcpvp

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    No sequence available.