PDB entry 5e7f

View 5e7f on RCSB PDB site
Description: Complex between lactococcal phage Tuc2009 RBP head domain and a nanobody (L06)
Class: viral protein
Keywords: bacteriophages, Lactococcus lactis, Siphoviridae, receptor binding protein, single-chain nanobody, viral protein
Deposited on 2015-10-12, released 2015-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nanobody L06
    Species: Camelus dromedarius [TaxId:9838]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5E7F (0-End)
    Domains in SCOPe 2.07: d5e7fa1, d5e7fa2
  • Chain 'B':
    Compound: nanobody L06
    Species: Camelus dromedarius [TaxId:9838]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5E7F (0-End)
    Domains in SCOPe 2.07: d5e7fb1, d5e7fb2
  • Chain 'C':
    Compound: nanobody L06
    Species: Camelus dromedarius [TaxId:9838]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5E7F (0-End)
    Domains in SCOPe 2.07: d5e7fc1, d5e7fc2
  • Chain 'G':
    Compound: Major structural protein 1
    Species: Lactococcus phage Tuc2009 [TaxId:35241]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38610 (Start-172)
      • expression tag (173)
  • Chain 'H':
    Compound: Major structural protein 1
    Species: Lactococcus phage Tuc2009 [TaxId:35241]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38610 (Start-172)
      • expression tag (173)
  • Chain 'I':
    Compound: Major structural protein 1
    Species: Lactococcus phage Tuc2009 [TaxId:35241]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38610 (Start-172)
      • expression tag (173)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e7fA (A:)
    qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya
    dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq
    vtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e7fA (A:)
    qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya
    dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq
    vtvssh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e7fB (B:)
    qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya
    dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq
    vtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e7fB (B:)
    qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya
    dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq
    vtvss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5e7fC (C:)
    qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya
    dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq
    vtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e7fC (C:)
    qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya
    dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq
    vtvsshhhh
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.