PDB entry 5e7b

View 5e7b on RCSB PDB site
Description: Structure of a nanobody (vHH) from camel against phage Tuc2009 RBP (BppL, ORF53)
Class: immune system
Keywords: bacteriophages, Lactococcus lactis, receptor binding protein, single-chain nanobody, immune system
Deposited on 2015-10-12, released 2015-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nanobody nano-L06
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 5E7B (0-End)
    Domains in SCOPe 2.07: d5e7ba1, d5e7ba2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e7bA (A:)
    qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya
    dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq
    vtvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e7bA (A:)
    qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya
    dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq
    vtvssh