PDB entry 5e70

View 5e70 on RCSB PDB site
Description: Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin
Class: transferase
Keywords: Branching Enzyme, Cyclodextrin, Glycogen, Starch, glucan, TRANSFERASE
Deposited on 2015-10-11, released 2015-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli O139:H28 (strain E24377A / ETEC) [TaxId:331111]
    Gene: glgB, EcE24377A_3911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e70a1, d5e70a2, d5e70a3
  • Chain 'B':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli O139:H28 (strain E24377A / ETEC) [TaxId:331111]
    Gene: glgB, EcE24377A_3911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e70b1, d5e70b2, d5e70b3
  • Chain 'C':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli O139:H28 (strain E24377A / ETEC) [TaxId:331111]
    Gene: glgB, EcE24377A_3911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e70c1, d5e70c2, d5e70c3
  • Chain 'D':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Escherichia coli O139:H28 (strain E24377A / ETEC) [TaxId:331111]
    Gene: glgB, EcE24377A_3911
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e70d1, d5e70d2, d5e70d3
  • Heterogens: RCD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e70A (A:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e70A (A:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehstliynygrrevsnflvgnalywierfgidalrvdavasmiyrgrenleaieflrnt
    nrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvyrqy
    hhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwafpg
    kkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamheldfd
    pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd
    smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e70B (B:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e70B (B:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpretliynygrrevsnflvgnalywierfgidalrvdavasmiyrdyewipnefg
    grenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhd
    tldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfa
    nlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnl
    tyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfg
    inqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5e70C (C:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e70C (C:)
    hlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwel
    fipgahngqlykyemidangnlrlksdpyafeaqetaslicglpekvvqteerkkanqfd
    apisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdgswgy
    qptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnlyehs
    liynygrrevsnflvgnalywierfgidalrvdavasmiyrenleaieflrntnrilgeq
    vsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvyrqyhhdkltf
    gilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwafpgkkllfmg
    nefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamheldfdpygfewl
    vvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntdsmhyhgs
    nagnggtvhsdeiashgrqhslsltlpplatiwlvrea
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5e70D (D:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdys
    rkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglg
    fwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshdevvhgkksil
    drmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwh
    hgvqrlvrdlnltyrhhkamheldfdpygfewlvvddkersvlifvrrdkegneiivasn
    ftpvprhdyrfginqpgkwreilntdsmhyhgsnagnggtvhsdeiashgrqhslsltlp
    platiwlvreae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e70D (D:)
    thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
    lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpekvvqteerkka
    nqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlellpinehpfdg
    swgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddfalaefdgtnl
    yehsntliynygrrevsnflvgnalywierfgidalrvdavasmiyrdgrenleaieflr
    ntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkldpvyr
    qyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayygwmwaf
    pgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhkamheld
    fdpygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreiln
    tdsmhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae