PDB entry 5e6n

View 5e6n on RCSB PDB site
Description: Crystal structure of C. elegans LGG-2
Class: protein binding
Keywords: ubiquitin-like protein, Atg8 protein family, PROTEIN BINDING
Deposited on 2015-10-10, released 2016-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-06, with a file datestamp of 2015-12-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein lgg-2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: lgg-2, ZK593.6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q23536 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d5e6na1, d5e6na2
  • Chain 'B':
    Compound: Protein lgg-2
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: lgg-2, ZK593.6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q23536 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d5e6nb1, d5e6nb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e6nA (A:)
    gpgsfkerrpfherqkdveeirsqqpnkvpviierfdgerslplmdrckflvpehitvae
    lmsivrrrlqlhpqqaffllvnersmvsnsmsmsnlysqerdpdgfvymvytsqpafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e6nA (A:)
    pgsfkerrpfherqkdveeirsqqpnkvpviierfdgerslplmdrckflvpehitvael
    msivrrrlqlhpqqaffllvnersmnsmsmsnlysqerdpdgfvymvytsq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e6nB (B:)
    gpgsfkerrpfherqkdveeirsqqpnkvpviierfdgerslplmdrckflvpehitvae
    lmsivrrrlqlhpqqaffllvnersmvsnsmsmsnlysqerdpdgfvymvytsqpafg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e6nB (B:)
    gsfkerrpfherqkdveeirsqqpnkvpviierfdgerslplmdrckflvpehitvaelm
    sivrrrlqlhpqqaffllvnersmsmsmsnlysqerdpdgfvymvytsqp