PDB entry 5e5m

View 5e5m on RCSB PDB site
Description: Crystal structure of mouse CTLA-4 in complex with nanobody
Class: immune system
Keywords: The complex of mouse CTLA-4 with its nanobody, treatment of metastatic melanomas, IMMUNE SYSTEM
Deposited on 2015-10-08, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytotoxic t-lymphocyte protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: CTLA4, CD152
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e5ma_
  • Chain 'B':
    Compound: mouse anti CTLA-4 nanobody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5E5M
    Domains in SCOPe 2.07: d5e5mb_
  • Chain 'C':
    Compound: cytotoxic t-lymphocyte protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: CTLA4, CD152
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e5mc_
  • Chain 'D':
    Compound: mouse anti CTLA-4 nanobody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5E5M
    Domains in SCOPe 2.07: d5e5md_
  • Chain 'E':
    Compound: cytotoxic t-lymphocyte protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: CTLA4, CD152
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e5me_
  • Chain 'F':
    Compound: mouse anti CTLA-4 nanobody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5E5M
    Domains in SCOPe 2.07: d5e5mf_
  • Chain 'G':
    Compound: cytotoxic t-lymphocyte protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: CTLA4, CD152
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e5mg_
  • Chain 'H':
    Compound: mouse anti CTLA-4 nanobody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5E5M
    Domains in SCOPe 2.07: d5e5mh_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e5mA (A:)
    iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
    ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5mA (A:)
    iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
    ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e5mB (B:)
    maqvqlvesggglaqpggslrlscaasgstissvavgwyrqtpgnqrewvatsstsstta
    tyadsvkgrftisrdnakntiylqmnslkpedtavyycktgltnwgrgtqvtvssgglpe
    tgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5mB (B:)
    qvqlvesggglaqpggslrlscaasgstissvavgwyrqtpgnqrewvatsstssttaty
    adsvkgrftisrdnakntiylqmnslkpedtavyycktgltnwgrgtqvtvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5e5mC (C:)
    iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
    ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5mC (C:)
    iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
    ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5e5mD (D:)
    maqvqlvesggglaqpggslrlscaasgstissvavgwyrqtpgnqrewvatsstsstta
    tyadsvkgrftisrdnakntiylqmnslkpedtavyycktgltnwgrgtqvtvssgglpe
    tgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5mD (D:)
    vqlvesggglaqpggslrlscaasgstissvavgwyrqtpgnqrewvatsstssttatya
    dsvkgrftisrdnakntiylqmnslkpedtavyycktgltnwgrgtqvtvs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5e5mE (E:)
    iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
    ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5mE (E:)
    iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
    ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5e5mF (F:)
    maqvqlvesggglaqpggslrlscaasgstissvavgwyrqtpgnqrewvatsstsstta
    tyadsvkgrftisrdnakntiylqmnslkpedtavyycktgltnwgrgtqvtvssgglpe
    tgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5mF (F:)
    vqlvesggglaqpggslrlscaasgstissvavgwyrqtpgnqrewvatsstssttatya
    dsvkgrftisrdnakntiylqmnslkpedtavyycktgltnwgrgtqvtvs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5e5mG (G:)
    iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
    ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5mG (G:)
    iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
    ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvid
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5e5mH (H:)
    maqvqlvesggglaqpggslrlscaasgstissvavgwyrqtpgnqrewvatsstsstta
    tyadsvkgrftisrdnakntiylqmnslkpedtavyycktgltnwgrgtqvtvssgglpe
    tgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e5mH (H:)
    vqlvesggglaqpggslrlscaasgstissvavgwyrqtpgnqrewvatsstssttatya
    dsvkgrftisrdnakntiylqmnslkpedtavyycktgltnwgrgtqvtv