PDB entry 5e4w

View 5e4w on RCSB PDB site
Description: Crystal structure of cpSRP43 chromodomains 2 and 3 in complex with the Alb3 tail
Class: transport protein
Keywords: Signal recognition particle, chromodomain, membrane insertase Alb3, chloroplast, signaling protein, transport protein
Deposited on 2015-10-07, released 2015-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thioredoxin-1
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: trxA, Z5291, ECs4714
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA27 (0-106)
    • expression tag (107-108)
  Domains in SCOPe 2.08: d5e4wa1, d5e4wa2
• Chain 'B':
  Compound: Thioredoxin-1
  Species: Escherichia coli O157:H7 [TaxId:83334]
  Gene: trxA, Z5291, ECs4714
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA27 (0-106)
    • expression tag (107)
  Domains in SCOPe 2.08: d5e4wb1, d5e4wb2
• Chain 'C':
  Compound: Signal recognition particle 43 kDa protein, chloroplastic
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: CAO, CPSRP43, At2g47450, T30B22.25
  Database cross-references and differences (RAF-indexed):
  • Uniprot O22265 (0-104)
• Chain 'D':
  Compound: Signal recognition particle 43 kDa protein, chloroplastic
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: CAO, CPSRP43, At2g47450, T30B22.25
  Database cross-references and differences (RAF-indexed):
  • Uniprot O22265 (0-104)
• Chain 'E':
  Compound: Inner membrane protein ALBINO3, chloroplastic
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: ALB3, At2g28800, F8N16.9
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8LBP4 (0-8)
• Chain 'F':
  Compound: Inner membrane protein ALBINO3, chloroplastic
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: ALB3, At2g28800, F8N16.9
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8LBP4 (Start-8)
• Heterogens: GOL, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5e4wA (A:)
  dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
  qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanlags
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >5e4wB (B:)
  dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
  qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanlags
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5e4wB (B:)
  dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
  qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanlag
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.