PDB entry 5e4f

View 5e4f on RCSB PDB site
Description: The spring alpha-helix coordinates multiple modes of HCV NS3 helicase action
Class: hydrolase
Keywords: HCV NS3 Helicase, transition state, HYDROLASE
Deposited on 2015-10-05, released 2016-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease NS3
    Species: Hepatitis C virus genotype 1b (isolate Con1) [TaxId:333284]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e4fa1, d5e4fa2
  • Chain 'B':
    Compound: Serine protease NS3
    Species: Hepatitis C virus genotype 1b (isolate Con1) [TaxId:333284]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e4fb1, d5e4fb2
  • Heterogens: ALF, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5e4fA (A:)
    sppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgi
    dpnirtgvrtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvld
    qaetagarlvvlatatppgsvtvphpnieevalsstgeipfygkaipietikggrhlifc
    hskkkcdelaaklsglglnavayyrgldvsviptsgdvivvatdalmtgftgdfdsvidc
    ntcvtqtvdfsldptftietttvpqdavsrsqrrgrtgrgrmgiyrfvtpgerpsgmfds
    svlcecydagcawyeltpaetsvrlraylntpglpvcqdhlefwesvftglthidahfls
    qtkqagdnfpylvayqatvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqne
    vttthpitkyimacmsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e4fB (B:)
    sppavpqtfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgi
    dpnirtgvrtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvld
    qaetagarlvvlatatppgsvtvphpnieevalsstgeipfygkaipietikggrhlifc
    hskkkcdelaaklsglglnavayyrgldvsviptsgdvivvatdalmtgftgdfdsvidc
    ntcvtqtvdfsldptftietttvpqdavsrsqrrgrtgrgrmgiyrfvtpgerpsgmfds
    svlcecydagcawyeltpaetsvrlraylntpglpvcqdhlefwesvftglthidahfls
    qtkqagdnfpylvayqatvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqne
    vttthpitkyimacmsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e4fB (B:)
    fqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgidpnirtgv
    rtittgapitystygkfladggcsggaydiiicdechstdsttilgigtvldqaetagar
    lvvlatatppgsvtvphpnieevalsstgeipfygkaipietikggrhlifchskkkcde
    laaklsglglnavayyrgldvsviptsgdvivvatdalmtgftgdfdsvidcntcvtqtv
    dfsldptftietttvpqdavsrsqrrgrtgrgrmgiyrfvtpgerpsgmfdssvlcecyd
    agcawyeltpaetsvrlraylntpglpvcqdhlefwesvftglthidahflsqtkqagdn
    fpylvayqatvcaraqapppswdqmwkclirlkptlhgptpllyrlgavqnevttthpit
    kyimacmsa