PDB entry 5e3x

View 5e3x on RCSB PDB site
Description: Crystal structure of thermostable Carboxypeptidase (FisCP) from Fervidobacterium Islandicum AW-1
Class: hydrolase
Keywords: Carboxypeptidase, Fervidobacterium, FisCP, HYDROLASE
Deposited on 2015-10-05, released 2016-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-10, with a file datestamp of 2016-02-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermostable carboxypeptidase 1
    Species: Fervidobacterium islandicum [TaxId:2423]
    Database cross-references and differences (RAF-indexed):
    • PDB 5E3X (0-488)
    Domains in SCOPe 2.07: d5e3xa_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5e3xA (A:)
    meelksyykrvakyysaaallywdmqtympkdagpyraevlseigtyafkqitddalgkl
    letaqpqseideklvyvgkkeyykykkvppelfqeimitstmleqkweiakprgdfeevr
    pllekivdlsrkyadilgyegepynalldlyepgmkaeevdqifskvrdfivevlekier
    lpksedpfnreigvdkqkefsnwllhylkydftkgrldvsahpftnpiglndvrittryi
    vndirnsiystihefghalyalsiptefyglpigssasygfdesqsrfwenvvgrslafw
    kgiyskfieivpemrgysveelwravnrvqrsfirteadevtynlhiiirfeiereling
    elsvkdvpdkwnelykkylgldvpnntlgcmqdphwfggnfgyfptyalgnlyaaqifek
    lkeeinfeevvsagnfeiiknflkekihskgkmyepsdlikivtgkplsyesfvryikdk
    yskvyeiel