PDB entry 5e3j

View 5e3j on RCSB PDB site
Description: The response regulator RstA is a potential drug target for Acinetobacter baumannii
Class: transcription
Keywords: response regulator, Acinetobacter baumannii, essential gene, antibiotic target, TRANSCRIPTION
Deposited on 2015-10-02, released 2016-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator RstA
    Species: Acinetobacter baumannii [TaxId:557600]
    Gene: ABBFA_002866
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e3ja_
  • Chain 'B':
    Compound: Response regulator RstA
    Species: Acinetobacter baumannii [TaxId:557600]
    Gene: ABBFA_002866
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e3jb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e3jA (A:)
    ghmsqeeklpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvld
    vmlpgadgltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllari
    rallrrtdktve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e3jA (A:)
    klpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpgad
    gltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrrt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e3jB (B:)
    ghmsqeeklpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvld
    vmlpgadgltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllari
    rallrrtdktve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e3jB (B:)
    klpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpgad
    gltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrrt