PDB entry 5e25

View 5e25 on RCSB PDB site
Description: Crystal structure of branched-chain aminotransferase from thermophilic archaea Geoglobus acetivorans complexed with alpha-ketoglutarate
Class: transferase
Keywords: aminotransferase, branched-chain, PLP, BCAT, Geoglobus acetivorans, TRANSFERASE, alpha-ketoglutarate, complex
Deposited on 2015-09-30, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain aminotransferase
    Species: Geoglobus acetivorans [TaxId:565033]
    Gene: GACE_1900
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e25a_
  • Chain 'B':
    Compound: branched-chain aminotransferase
    Species: Geoglobus acetivorans [TaxId:565033]
    Gene: GACE_1900
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e25b_
  • Chain 'C':
    Compound: branched-chain aminotransferase
    Species: Geoglobus acetivorans [TaxId:565033]
    Gene: GACE_1900
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e25c_
  • Heterogens: PLP, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e25A (A:)
    sellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvi
    dlkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwg
    klygdlyekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhng
    yisegsgdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysad
    eifvtgtaaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e25A (A:)
    sellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvi
    dlkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwg
    klygdlyekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhng
    yisegsgdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysad
    eifvtgtaaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e25B (B:)
    sellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvi
    dlkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwg
    klygdlyekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhng
    yisegsgdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysad
    eifvtgtaaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e25B (B:)
    ellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvid
    lkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwgk
    lygdlyekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhngy
    isegsgdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysade
    ifvtgtaaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5e25C (C:)
    sellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvi
    dlkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwg
    klygdlyekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhng
    yisegsgdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysad
    eifvtgtaaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e25C (C:)
    sellvymngefvpesqakvsvfdhgflygdgvfegirayngkvfklyehidrlydcarvi
    dlkiplskeefaeailetlrrnnlrdayirpivtrgagdlgldprkcpspnviiitkpwl
    yekglkaitvairrnaidslppnikslnylnnilakieanakggdeaifldhngyisegs
    gdnifivkngtittpptlnnlkgitrqvvielineleipfreaniglfdlysadeifvtg
    taaeiapvtyidgrtvgngkpgkvtkmlmekfrertenegveiyr