PDB entry 5e1n

View 5e1n on RCSB PDB site
Description: Selenomethionine Ca2+-Calmodulin from Paramecium tetraurelia qFit disorder model
Class: metal binding protein
Keywords: calcium signaling, EF hand, calcium binding, METAL BINDING PROTEIN
Deposited on 2015-09-29, released 2015-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Paramecium tetraurelia [TaxId:5888]
    Gene: CAM, GSPATT00015825001
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e1na_
  • Heterogens: MPD, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e1nA (A:)
    aeqlteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
    gtidfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltdde
    vdemireadidgdghinyeefvrmmvsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e1nA (A:)
    qlteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
    idfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltddevd
    emireadidgdghinyeefvrmmvs