PDB entry 5e03

View 5e03 on RCSB PDB site
Description: Crystal structure of mouse CTLA-4 nanobody
Class: signaling protein
Keywords: IG FOLD, mouse CTLA-4 nanobody, SIGNALING PROTEIN
Deposited on 2015-09-28, released 2015-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mouse CTLA-4 nanobody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5E03
    Domains in SCOPe 2.06: d5e03a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5e03A (A:)
maqvqlvesggglaqpggslrlscaasgstissvavgwyrqtpgnqrewvatsstsstta
tyadsvkgrftisrdnakntiylqmnslkpedtavyycktgltnwgrgtqvtvssgglpe
tgghhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >5e03A (A:)
vqlvesggglaqpggslrlscaasgstissvavgwyrqtpgnqrewvatsstssttatya
dsvkgrftisrdnakntiylqmnslkpedtavyycktgltnwgrgtqvtvssg